SSX4 (NM_005636) Human Mass Spec Standard
CAT#: PH324314
SSX4 MS Standard C13 and N15-labeled recombinant protein (NP_005627)
View other "SSX4" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SSX4 MS Standard C13 and N15-labeled recombinant protein (NP_005627) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224314 |
Predicted MW | 21.9 kDa |
Protein Sequence |
>RC224314 protein sequence
Red=Cloning site Green=Tags(s) MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPF MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLC PPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005627 |
RefSeq Size | 1250 |
RefSeq ORF | 564 |
Synonyms | CT5.4 |
Locus ID | 6759 |
Cytogenetics | Xp11.23 |
Summary | The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4, represents the more telomeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406243 | SSX4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC417167 | SSX4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406243 | Transient overexpression lysate of synovial sarcoma, X breakpoint 4 (SSX4), transcript variant 2 |
CNY 3,080.00 |
|
LY417167 | Transient overexpression lysate of synovial sarcoma, X breakpoint 4 (SSX4), transcript variant 1 |
CNY 3,080.00 |
|
TP324314 | Recombinant protein of human synovial sarcoma, X breakpoint 4 (SSX4), transcript variant 1, 20 µg |
CNY 2,900.00 |