ADH7 (NM_000673) Human Mass Spec Standard
CAT#: PH324304
ADH7 MS Standard C13 and N15-labeled recombinant protein (NP_000664)
View other "ADH7" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ADH7 MS Standard C13 and N15-labeled recombinant protein (NP_000664) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224304 |
Predicted MW | 41.5 kDa |
Protein Sequence |
>RC224304 protein sequence
Red=Cloning site Green=Tags(s) MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTM VSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTT RFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVF GLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEV IGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAK KFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000664 |
RefSeq Size | 2307 |
RefSeq ORF | 1158 |
Synonyms | ADH4 |
Locus ID | 131 |
Cytogenetics | 4q23 |
Summary | This gene encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The enzyme encoded by this gene is inefficient in ethanol oxidation, but is the most active as a retinol dehydrogenase; thus it may participate in the synthesis of retinoic acid, a hormone important for cellular differentiation. The expression of this gene is much more abundant in stomach than liver, thus differing from the other known gene family members. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Fatty acid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424575 | ADH7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432990 | ADH7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424575 | Transient overexpression lysate of alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 2 |
CNY 3,080.00 |
|
LY432990 | Transient overexpression lysate of alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 1 |
CNY 3,080.00 |
|
TP324304 | Recombinant protein of human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), 20 µg |
CNY 2,900.00 |