United States
Germany
Japan
United Kingdom
China
OIF (OGN) (NM_033014) Human Mass Spec Standard
CAT＃: PH323948
OGN MS Standard C13 and N15-labeled recombinant protein (NP_148935)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | OGN MS Standard C13 and N15-labeled recombinant protein (NP_148935) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223948 |
| Predicted MW | 31.8 kDa |
| Protein Sequence |
>RC223948 representing NM_033014
Red=Cloning site Green=Tags(s) MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG KHPNSFICLKRLPIGSYF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_148935 |
| RefSeq Size | 2976 |
| RefSeq ORF | 894 |
| Synonyms | OG; OIF; SLRR3A |
| Locus ID | 4969 |
| Cytogenetics | 9q22.31 |
| Summary | This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded protein induces ectopic bone formation in conjunction with transforming growth factor beta and may regulate osteoblast differentiation. High expression of the encoded protein may be associated with elevated heart left ventricular mass. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403216 | OGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411273 | OGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415500 | OGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403216 | Transient overexpression lysate of osteoglycin (OGN), transcript variant 1 |
CNY 3,080.00 |
|
| LY411273 | Transient overexpression lysate of osteoglycin (OGN), transcript variant 2 |
CNY 3,080.00 |
|
| LY415500 | Transient overexpression lysate of osteoglycin (OGN), transcript variant 3 |
CNY 3,080.00 |
|
| PH310651 | OGN MS Standard C13 and N15-labeled recombinant protein (NP_054776) |
CNY 19,520.00 |
|
| TP310651 | Recombinant protein of human osteoglycin (OGN), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP323948 | Recombinant protein of human osteoglycin (OGN), transcript variant 1, 20 µg |
CNY 2,900.00 |
