EXOC7 (NM_015219) Human Mass Spec Standard
CAT#: PH322329
EXOC7 MS Standard C13 and N15-labeled recombinant protein (NP_056034)
View other "EXOC7" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | EXOC7 MS Standard C13 and N15-labeled recombinant protein (NP_056034) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222329 |
Predicted MW | 74.5 kDa |
Protein Sequence |
>RC222329 representing NM_015219
Red=Cloning site Green=Tags(s) MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSIIPVHKQTENL QRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQKAVEYFQDNSPDSPELNKVK LLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLEHLPESVLQDVIRISRWLVEYG RNQDFMNVYYQIRSSQLDRSIKGLKEHFHKSSSSSGVPYSPAIPNKRKDTPTKKPVKRPGRDDMLDVETD AYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKAIVRHDFSTVLTV FPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFADNIKNDPDKEYNMPKDGTVHEL TSNAILFLQQLLDFQETAGAMLASQETSSSATSYSSEFSKRLLSTYICKVLGNLQLNLLSKSKVYEDPAL SAIFLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQIQTYQRSWLKVTDYIAEKNLPVFQPGV KLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNP EKYIKYGVEQVGDMIDRLFDTSA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056034 |
RefSeq Size | 4687 |
RefSeq ORF | 1959 |
Synonyms | 2-5-3p; BLOM4; EX070; EXO70; Exo70p; EXOC1; NEDSEBA; YJL085W |
Locus ID | 23265 |
Cytogenetics | 17q25.1 |
Summary | The protein encoded by this gene is a component of the exocyst complex. The exocyst complex plays a critical role in vesicular trafficking and the secretory pathway by targeting post-Golgi vesicles to the plasma membrane. The encoded protein is required for assembly of the exocyst complex and docking of the complex to the plasma membrane. The encoded protein may also play a role in pre-mRNA splicing through interactions with pre-mRNA-processing factor 19. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 4. [provided by RefSeq, Nov 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Insulin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC428802 | EXOC7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC428803 | EXOC7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY428802 | Transient overexpression lysate of exocyst complex component 7 (EXOC7), transcript variant 5 |
CNY 4,840.00 |
|
LY428803 | Transient overexpression lysate of exocyst complex component 7 (EXOC7), transcript variant 6 |
CNY 4,840.00 |
|
PH327527 | EXOC7 MS Standard C13 and N15-labeled recombinant protein (NP_001138771) |
CNY 14,250.00 |
|
TP322329 | Recombinant protein of human exocyst complex component 7 (EXOC7), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP327527 | Purified recombinant protein of Homo sapiens exocyst complex component 7 (EXOC7), transcript variant 6, 20 µg |
CNY 2,900.00 |