Kv1.2 (KCNA2) (NM_004974) Human Mass Spec Standard
CAT#: PH322200
KCNA2 MS Standard C13 and N15-labeled recombinant protein (NP_004965)
View other "Kv1.2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | KCNA2 MS Standard C13 and N15-labeled recombinant protein (NP_004965) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222200 |
Predicted MW | 56.5 kDa |
Protein Sequence |
>RC222200 representing NM_004974
Red=Cloning site Green=Tags(s) MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFD PLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPL PENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSNSTI GYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPED AQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE ADERESQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYV NITKMLTDV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004965 |
RefSeq Size | 2142 |
RefSeq ORF | 1497 |
Synonyms | DEE32; EIEE32; HBK5; HK4; HUKIV; KV1.2; MK2; NGK1; RBK2 |
Locus ID | 3737 |
Cytogenetics | 1p13.3 |
Summary | Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of this gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401550 | KCNA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401550 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2) |
CNY 4,840.00 |
|
TP322200 | Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, member 2 (KCNA2), 20 µg |
CNY 2,900.00 |