SOX14 (NM_004189) Human Mass Spec Standard
CAT#: PH322052
SOX14 MS Standard C13 and N15-labeled recombinant protein (NP_004180)
View other "SOX14" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SOX14 MS Standard C13 and N15-labeled recombinant protein (NP_004180) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222052 |
Predicted MW | 26.5 kDa |
Protein Sequence |
>RC222052 protein sequence
Red=Cloning site Green=Tags(s) MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMK EHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLD PAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSAS TLQPPVAYILFPGMTKTGIDPYSSAHATAM SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004180 |
RefSeq Size | 2043 |
RefSeq ORF | 720 |
Synonyms | SOX28 |
Locus ID | 8403 |
Cytogenetics | 3q22.3 |
Summary | This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418159 | SOX14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418159 | Transient overexpression lysate of SRY (sex determining region Y)-box 14 (SOX14) |
CNY 3,080.00 |
|
TP322052 | Recombinant protein of human SRY (sex determining region Y)-box 14 (SOX14), 20 µg |
CNY 2,900.00 |