LIN7 (LIN7A) (NM_004664) Human Mass Spec Standard
CAT#: PH321902
LIN7A MS Standard C13 and N15-labeled recombinant protein (NP_004655)
View other "LIN7" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LIN7A MS Standard C13 and N15-labeled recombinant protein (NP_004655) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221902 |
Predicted MW | 26 kDa |
Protein Sequence |
>RC221902 protein sequence
Red=Cloning site Green=Tags(s) MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQ YMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPG GVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQ QQQLLIQQQQQQQQQQTQQNHMS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004655 |
RefSeq Size | 1235 |
RefSeq ORF | 699 |
Synonyms | LIN-7A; LIN7; MALS-1; MALS1; TIP-33; VELI1 |
Locus ID | 8825 |
Cytogenetics | 12q21.31 |
Summary | The protein encoded by this gene is involved in generating and maintaining the asymmetric distribution of channels and receptors at the cell membrane. The encoded protein also is required for the localization of some specific channels and can be part of a protein complex that couples synaptic vesicle exocytosis to cell adhesion in the brain. [provided by RefSeq, May 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417838 | LIN7A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417838 | Transient overexpression lysate of lin-7 homolog A (C. elegans) (LIN7A) |
CNY 3,080.00 |
|
TP321902 | Recombinant protein of human lin-7 homolog A (C. elegans) (LIN7A), 20 µg |
CNY 2,900.00 |