CLEC2D (NM_001004419) Human Mass Spec Standard
CAT#: PH321680
CLEC2D MS Standard C13 and N15-labeled recombinant protein (NP_001004419)
View other "CLEC2D" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CLEC2D MS Standard C13 and N15-labeled recombinant protein (NP_001004419) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221680 |
Predicted MW | 22.1 kDa |
Protein Sequence |
>RC221680 representing NM_001004419
Red=Cloning site Green=Tags(s) MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG QPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001004419 |
RefSeq Size | 1821 |
RefSeq ORF | 582 |
Synonyms | CLAX; LLT1; OCIL |
Locus ID | 29121 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415703 | CLEC2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423748 | CLEC2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433996 | CLEC2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415703 | Transient overexpression lysate of C-type lectin domain family 2, member D (CLEC2D), transcript variant 1 |
CNY 3,080.00 |
|
LY423748 | Transient overexpression lysate of C-type lectin domain family 2, member D (CLEC2D), transcript variant 2 |
CNY 3,080.00 |
|
LY433996 | Transient overexpression lysate of C-type lectin domain family 2, member D (CLEC2D), transcript variant 3 |
CNY 3,080.00 |
|
TP321680 | Recombinant protein of human C-type lectin domain family 2, member D (CLEC2D), transcript variant 2, 20 µg |
CNY 2,900.00 |