Olfactory Marker Protein (OMP) (NM_006189) Human Mass Spec Standard
CAT#: PH321572
OMP MS Standard C13 and N15-labeled recombinant protein (NP_006180)
View other "Olfactory Marker Protein" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | OMP MS Standard C13 and N15-labeled recombinant protein (NP_006180) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221572 |
Predicted MW | 18.8 kDa |
Protein Sequence |
>RC221572 representing NM_006189
Red=Cloning site Green=Tags(s) MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNV VLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMY FLVTFGEGVEPANLKASVVFNQL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006180 |
RefSeq Size | 492 |
RefSeq ORF | 489 |
Locus ID | 4975 |
Cytogenetics | 11q13.5 |
Summary | Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse knockout studies show that OMP-null mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416810 | OMP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416810 | Transient overexpression lysate of olfactory marker protein (OMP) |
CNY 3,080.00 |
|
TP321572 | Recombinant protein of human olfactory marker protein (OMP), 20 µg |
CNY 2,900.00 |
其它Olfactory Marker Protein产品