DEFB118 (NM_054112) Human Mass Spec Standard
CAT#: PH321558
DEFB118 MS Standard C13 and N15-labeled recombinant protein (NP_473453)
View other "DEFB118" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DEFB118 MS Standard C13 and N15-labeled recombinant protein (NP_473453) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221558 |
Predicted MW | 13.6 kDa |
Protein Sequence |
>RC221558 protein sequence
Red=Cloning site Green=Tags(s) MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSP TPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_473453 |
RefSeq Size | 1158 |
RefSeq ORF | 369 |
Synonyms | C20orf63; DEFB-18; ESC42; ESP13.6 |
Locus ID | 117285 |
Cytogenetics | 20q11.21 |
Summary | This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. Expression of this gene is regulated by androgen, and the encoded protein binds to sperm and exhibits antibacterial activity against E. coli. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409287 | DEFB118 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409287 | Transient overexpression lysate of defensin, beta 118 (DEFB118) |
CNY 3,080.00 |
|
TP321558 | Recombinant protein of human defensin, beta 118 (DEFB118), 20 µg |
CNY 2,900.00 |
其它DEFB118产品