BEX1 (NM_018476) Human Mass Spec Standard
CAT#: PH320965
BEX1 MS Standard C13 and N15-labeled recombinant protein (NP_060946)
View other "BEX1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | BEX1 MS Standard C13 and N15-labeled recombinant protein (NP_060946) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220965 |
Predicted MW | 14.9 kDa |
Protein Sequence |
>RC220965 protein sequence
Red=Cloning site Green=Tags(s) MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRL GEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060946 |
RefSeq Size | 862 |
RefSeq ORF | 375 |
Synonyms | BEX2; HBEX2; HGR74-h |
Locus ID | 55859 |
Cytogenetics | Xq22 |
Summary | Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413052 | BEX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413052 | Transient overexpression lysate of brain expressed, X-linked 1 (BEX1) |
CNY 3,080.00 |
|
TP320965 | Recombinant protein of human brain expressed, X-linked 1 (BEX1), 20 µg |
CNY 2,900.00 |