Lipophilin B (SCGB1D2) (NM_006551) Human Mass Spec Standard
CAT#: PH320905
SCGB1D2 MS Standard C13 and N15-labeled recombinant protein (NP_006542)
View other "Lipophilin B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SCGB1D2 MS Standard C13 and N15-labeled recombinant protein (NP_006542) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220905 |
Predicted MW | 9.9 kDa |
Protein Sequence |
>RC220905 protein sequence
Red=Cloning site Green=Tags(s) MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMS LQKRSLIAEVLVKILKKCSV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006542 |
RefSeq Size | 454 |
RefSeq ORF | 270 |
Synonyms | LIPB; LPHB; LPNB |
Locus ID | 10647 |
Cytogenetics | 11q12.3 |
Summary | The protein encoded by this gene is a member of the lipophilin subfamily, part of the uteroglobin superfamily, and is an ortholog of prostatein, the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin gene products are widely expressed in normal tissues, especially in endocrine-responsive organs. Assuming that human lipophilins are the functional counterparts of prostatein, they may be transcriptionally regulated by steroid hormones, with the ability to bind androgens, other steroids and possibly bind and concentrate estramustine, a chemotherapeutic agent widely used for prostate cancer. Although the gene has been reported to be on chromosome 10, this sequence appears to be from a cluster of genes on chromosome 11 that includes mammaglobin 2. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416566 | SCGB1D2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416566 | Transient overexpression lysate of secretoglobin, family 1D, member 2 (SCGB1D2) |
CNY 3,080.00 |
|
TP320905 | Recombinant protein of human secretoglobin, family 1D, member 2 (SCGB1D2), 20 µg |
CNY 2,900.00 |
其它Lipophilin B产品