OCIAD1 (NM_001079842) Human Mass Spec Standard
CAT#: PH320792
OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311)
View other "OCIAD1" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220792 |
Predicted MW | 21.4 kDa |
Protein Sequence |
>RC220792 representing NM_001079842
Red=Cloning site Green=Tags(s) MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGRNFS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001073311 |
RefSeq Size | 1754 |
RefSeq ORF | 561 |
Synonyms | ASRIJ; OCIA; TPA018 |
Locus ID | 54940 |
Cytogenetics | 4p11 |
Summary | Maintains stem cell potency (By similarity). Increases STAT3 phosphorylation and controls ERK phosphorylation (By similarity). May act as a scaffold, increasing STAT3 recruitment onto endosomes (By similarity). Involved in integrin-mediated cancer cell adhesion and colony formation in ovarian cancer (PubMed:20515946).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402620 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421553 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421556 | OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402620 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 1 |
CNY 3,080.00 |
|
LY421553 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 2 |
CNY 3,080.00 |
|
LY421556 | Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 5 |
CNY 3,080.00 |
|
PH301506 | OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_060300) |
CNY 19,520.00 |
|
TP301506 | Recombinant protein of human OCIA domain containing 1 (OCIAD1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP320792 | Purified recombinant protein of Homo sapiens OCIA domain containing 1 (OCIAD1), transcript variant 5, 20 µg |
CNY 2,900.00 |