H2AC21 (NM_175065) Human Mass Spec Standard
CAT#: PH320685
HIST2H2AB MS Standard C13 and N15-labeled recombinant protein (NP_778235)
View other "H2AC21" proteins (1)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HIST2H2AB MS Standard C13 and N15-labeled recombinant protein (NP_778235) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220685 |
Predicted MW | 13.8 kDa |
Protein Sequence |
>RC220685 representing NM_175065
Red=Cloning site Green=Tags(s) MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA ARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHKPGKNK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_778235 |
RefSeq Size | 448 |
RefSeq ORF | 390 |
Synonyms | H2AB; HIST2H2AB |
Locus ID | 317772 |
Cytogenetics | 1q21.2 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP320685 | Recombinant protein of human histone cluster 2, H2ab (HIST2H2AB), 20 µg |
CNY 2,900.00 |