TCEAL1 (NM_004780) Human Mass Spec Standard
CAT#: PH319873
TCEAL1 MS Standard C13 and N15-labeled recombinant protein (NP_004771)
View other "TCEAL1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TCEAL1 MS Standard C13 and N15-labeled recombinant protein (NP_004771) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219873 |
Predicted MW | 18.6 kDa |
Protein Sequence |
>RC219873 protein sequence
Red=Cloning site Green=Tags(s) MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQ EGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRV RNKLMIMHWKAKRSRPYPI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004771 |
RefSeq Size | 1220 |
RefSeq ORF | 477 |
Synonyms | p21; pp21; SIIR; WEX9 |
Locus ID | 9338 |
Cytogenetics | Xq22.2 |
Summary | This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417752 | TCEAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423535 | TCEAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423536 | TCEAL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417752 | Transient overexpression lysate of transcription elongation factor A (SII)-like 1 (TCEAL1), transcript variant 1 |
CNY 3,080.00 |
|
LY423535 | Transient overexpression lysate of transcription elongation factor A (SII)-like 1 (TCEAL1), transcript variant 2 |
CNY 3,080.00 |
|
LY423536 | Transient overexpression lysate of transcription elongation factor A (SII)-like 1 (TCEAL1), transcript variant 3 |
CNY 3,080.00 |
|
TP319873 | Recombinant protein of human transcription elongation factor A (SII)-like 1 (TCEAL1), transcript variant 1, 20 µg |
CNY 2,900.00 |