ADH6 (NM_001102470) Human Mass Spec Standard
CAT#: PH319515
ADH6 MS Standard C13 and N15-labeled recombinant protein (NP_001095940)
View other "ADH6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ADH6 MS Standard C13 and N15-labeled recombinant protein (NP_001095940) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219515 |
Predicted MW | 39.6 kDa |
Protein Sequence |
>RC219515 representing NM_001102470
Red=Cloning site Green=Tags(s) MSTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHE GAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYH FGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTGFGAAINTAKVTPGSTCAVFGLGGVGLSVVM GCKAAGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAAL ASCNESYGVCVVVGVLPASVQLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHT LNLDKINEAVELMKTGKCIRCILLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001095940 |
RefSeq Size | 2803 |
RefSeq ORF | 1125 |
Synonyms | ADH-5 |
Locus ID | 130 |
Cytogenetics | 4q23 |
Summary | This gene encodes class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This gene is expressed in the stomach as well as in the liver, and it contains a glucocorticoid response element upstream of its 5' UTR, which is a steroid hormone receptor binding site. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Fatty acid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism, Tyrosine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420155 | ADH6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420155 | Transient overexpression lysate of alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1 |
CNY 3,080.00 |
|
TP319515 | Recombinant protein of human alcohol dehydrogenase 6 (class V) (ADH6), transcript variant 1, 20 µg |
CNY 2,900.00 |