OR2J2 (NM_030905) Human Mass Spec Standard
CAT#: PH319467
OR2J2 MS Standard C13 and N15-labeled recombinant protein (NP_112167)
View other "OR2J2" proteins (1)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | OR2J2 MS Standard C13 and N15-labeled recombinant protein (NP_112167) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219467 |
Predicted MW | 35.1 kDa |
Protein Sequence |
>RC219467 representing NM_030905
Red=Cloning site Green=Tags(s) MMIKKNASSEDFFILLGFSNWPQLEVVLFVVILIFYLMTLTGNLFIIILSYVDSHLHTPMYFFLSNLSFL DLCYTTSSIPQLLVNLRGPEKTISYAGCMVQLYFVLALGITECVLLVVMSYDRYVAVCRPLHYTVLMHPR FCHLLVAASWVIGFTISALHSSFTFWVPLCGHRLVDHFFCEVPALLRLSCVDTHANELTLMVMSSIFVLI PLILILTTYGAIARAVLSMQSTTGLQKVFRTCGAHLMVVSLFFIPVMCMYLQPPSENSPDQGKFIALFYT VVTPSLNPLIYTLRNKHVKGAAKRLLGWEWGK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112167 |
RefSeq Size | 939 |
RefSeq ORF | 936 |
Synonyms | dJ80I19.4; hs6M1-6; OR6-8; OR6-19; OR6.3.8; ORL684 |
Locus ID | 26707 |
Cytogenetics | 6p22.1 |
Summary | Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Olfactory transduction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP319467 | Purified recombinant protein of Homo sapiens olfactory receptor, family 2, subfamily J, member 2 (OR2J2), 20 µg |
CNY 2,900.00 |