CCDC46 (CEP112) (NM_001037325) Human Mass Spec Standard
CAT#: PH319337
CCDC46 MS Standard C13 and N15-labeled recombinant protein (NP_001032402)
View other "CCDC46" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CCDC46 MS Standard C13 and N15-labeled recombinant protein (NP_001032402) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219337 |
Predicted MW | 24.4 kDa |
Protein Sequence |
>RC219337 representing NM_001037325
Red=Cloning site Green=Tags(s) MWASLSLDHPSAKENQALRLIEMREENGNVPKTEQAGSLKPLRDTGKSNLKEKKANSKLKQIEKEYTQKL AKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFEDEKKQLIRDNDQAIKVLQDELENRSNQVRC AEKKLQHKELESQEQITYIRQEYETKLKGLMPASLRQELEDTISSLKSQVNFLQKRASILQEELTTYQGR R myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001032402 |
RefSeq Size | 1258 |
RefSeq ORF | 633 |
Synonyms | CCDC46; MACOCO; SPGF44 |
Locus ID | 201134 |
Cytogenetics | 17q24.1 |
Summary | This gene encodes a coiled-coil domain containing protein that belongs to the cell division control protein 42 effector protein family. In neurons, it localizes to the cytoplasm of dendrites and is also enriched in the nucleus where it interacts with the RNA polymerase III transcriptional repressor Maf1 to regulate gamma-aminobutyric acid A receptor surface expression. In addition, the protein has been identified as a component of the human centrosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421947 | CEP112 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421947 | Transient overexpression lysate of coiled-coil domain containing 46 (CCDC46), transcript variant 2 |
CNY 3,080.00 |
|
TP319337 | Recombinant protein of human coiled-coil domain containing 46 (CCDC46), transcript variant 2, 20 µg |
CNY 2,900.00 |