United States
Germany
Japan
United Kingdom
China
C4BPB (NM_001017367) Human Mass Spec Standard
CAT＃: PH319216
C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017367)
View other "C4BPB" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017367) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219216 |
| Predicted MW | 28.3 kDa |
| Protein Sequence |
>RC219216 protein sequence
Red=Cloning site Green=Tags(s) MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWDN TTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDP PGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQE SKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001017367 |
| RefSeq Size | 967 |
| RefSeq ORF | 753 |
| Synonyms | C4BP |
| Locus ID | 725 |
| Cytogenetics | 1q32.1 |
| Summary | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Complement and coagulation cascades |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422638 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422639 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422641 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424545 | C4BPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422638 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 2 |
CNY 3,080.00 |
|
| LY422639 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 3 |
CNY 3,080.00 |
|
| LY422641 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 5 |
CNY 3,080.00 |
|
| LY424545 | Transient overexpression lysate of complement component 4 binding protein, beta (C4BPB), transcript variant 1 |
CNY 3,080.00 |
|
| PH302799 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017365) |
CNY 14,250.00 |
|
| PH319158 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_001017364) |
CNY 14,250.00 |
|
| PH323685 | C4BPB MS Standard C13 and N15-labeled recombinant protein (NP_000707) |
CNY 14,250.00 |
|
| TP302799 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP319158 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP319216 | Purified recombinant protein of Homo sapiens complement component 4 binding protein, beta (C4BPB), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP323685 | Recombinant protein of human complement component 4 binding protein, beta (C4BPB), transcript variant 1, 20 µg |
CNY 2,900.00 |
