Ficolin 2 (FCN2) (NM_015837) Human Mass Spec Standard
CAT#: PH318750
FCN2 MS Standard C13 and N15-labeled recombinant protein (NP_056652)
View other "Ficolin 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | FCN2 MS Standard C13 and N15-labeled recombinant protein (NP_056652) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218750 |
Predicted MW | 30.23 kDa |
Protein Sequence |
>RC218750 representing NM_015837
Red=Cloning site Green=Tags(s) MELDRAVGVLGAATLLLSFLGMAWALQAADTCPGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDL LDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGND NIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQ DNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056652 |
RefSeq Size | 943 |
RefSeq ORF | 825 |
Synonyms | EBP-37; FCNL; ficolin-2; P35 |
Locus ID | 2220 |
Cytogenetics | 9q34.3 |
Summary | The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414367 | FCN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414367 | Transient overexpression lysate of ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin) (FCN2), transcript variant SV1 |
CNY 3,080.00 |
|
TP318750 | Recombinant protein of human ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin) (FCN2), transcript variant SV1, 20 µg |
CNY 2,900.00 |
其它Ficolin 2产品