SMAGP (NM_001031628) Human Mass Spec Standard
CAT#: PH318509
SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001026798)
View other "SMAGP" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001026798) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218509 |
Predicted MW | 10.7 kDa |
Protein Sequence |
>RC218509 protein sequence
Red=Cloning site Green=Tags(s) MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYE PTEGEPSAIVQMESDLAKGSEKEEYFI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001026798 |
RefSeq Size | 1087 |
RefSeq ORF | 291 |
Synonyms | hSMAGP |
Locus ID | 57228 |
Cytogenetics | 12q13.13 |
Summary | May play a role in epithelial cell-cell contacts. May play a role in tumor invasiveness and metastasis formation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422217 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422425 | SMAGP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422217 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 1 |
CNY 3,080.00 |
|
LY422425 | Transient overexpression lysate of small cell adhesion glycoprotein (SMAGP), transcript variant 2 |
CNY 3,080.00 |
|
PH303589 | SMAGP MS Standard C13 and N15-labeled recombinant protein (NP_001029045) |
CNY 19,520.00 |
|
TP303589 | Recombinant protein of human small trans-membrane and glycosylated protein (LOC57228), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP318509 | Recombinant protein of human small trans-membrane and glycosylated protein (LOC57228), transcript variant 1, 20 µg |
CNY 2,900.00 |