CMTM7 (NM_181472) Human Mass Spec Standard
CAT#: PH318395
CMTM7 MS Standard C13 and N15-labeled recombinant protein (NP_852137)
View other "CMTM7" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | CMTM7 MS Standard C13 and N15-labeled recombinant protein (NP_852137) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218395 |
Predicted MW | 15.3 kDa |
Protein Sequence |
>RC218395 representing NM_181472
Red=Cloning site Green=Tags(s) MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTN YSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSIFGFMATFLCMASIWLSYKISCVTQSTDA AV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_852137 |
RefSeq Size | 1270 |
RefSeq ORF | 426 |
Synonyms | CKLFSF7 |
Locus ID | 112616 |
Cytogenetics | 3p22.3 |
Summary | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408668 | CMTM7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408668 | Transient overexpression lysate of CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 1 |
CNY 3,080.00 |
|
TP318395 | Recombinant protein of human CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 2, 20 µg |
CNY 2,900.00 |