United States
Germany
Japan
United Kingdom
China
DUSP13 (NM_001007272) Human Mass Spec Standard
CAT＃: PH318322
DUSP13 MS Standard C13 and N15-labeled recombinant protein (NP_001007273)
View other "DUSP13" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | DUSP13 MS Standard C13 and N15-labeled recombinant protein (NP_001007273) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218322 |
| Predicted MW | 27.3 kDa |
| Protein Sequence |
>RC218322 representing NM_001007272
Red=Cloning site Green=Tags(s) MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAMDSLQKQDLRRPKIHGAVQA SPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAK FYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMT LVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRF TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001007273 |
| RefSeq Size | 1063 |
| RefSeq ORF | 744 |
| Synonyms | BEDP; DUSP13A; DUSP13B; MDSP; SKRP4; TMDP |
| Locus ID | 51207 |
| Cytogenetics | 10q22.2 |
| Summary | Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413984 | DUSP13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423481 | DUSP13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423482 | DUSP13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413984 | Transient overexpression lysate of dual specificity phosphatase 13 (DUSP13), transcript variant 6 |
CNY 3,080.00 |
|
| LY423481 | Transient overexpression lysate of dual specificity phosphatase 13 (DUSP13), transcript variant 2 |
CNY 3,080.00 |
|
| LY423482 | Transient overexpression lysate of dual specificity phosphatase 13 (DUSP13), transcript variant 3 |
CNY 3,080.00 |
|
| PH303085 | DUSP13 MS Standard C13 and N15-labeled recombinant protein (NP_057448) |
CNY 19,520.00 |
|
| TP303085 | Recombinant protein of human dual specificity phosphatase 13 (DUSP13), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
| TP318322 | Recombinant protein of human dual specificity phosphatase 13 (DUSP13), transcript variant 2, 20 µg |
CNY 2,900.00 |
