HHLA3 (NM_007071) Human Mass Spec Standard
CAT#: PH318069
HHLA3 MS Standard C13 and N15-labeled recombinant protein (NP_009002)
View other "HHLA3" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | HHLA3 MS Standard C13 and N15-labeled recombinant protein (NP_009002) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218069 |
Predicted MW | 8.5 kDa |
Protein Sequence |
>RC218069 representing NM_007071
Red=Cloning site Green=Tags(s) MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAVLSTERGPYPDPKRAFLD LLQERI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009002 |
RefSeq Size | 834 |
RefSeq ORF | 228 |
Synonyms | HERV-H LTR-associating 3; human endogenous retrovirus-H long terminal repeat-associating 3; OTTHUMP00000010943 |
Locus ID | 11147 |
Cytogenetics | 1p31.1 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416203 | HHLA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421904 | HHLA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422144 | HHLA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416203 | Transient overexpression lysate of HERV-H LTR-associating 3 (HHLA3), transcript variant 2 |
CNY 3,080.00 |
|
LY421904 | Transient overexpression lysate of HERV-H LTR-associating 3 (HHLA3), transcript variant 1 |
CNY 3,080.00 |
|
LY422144 | Transient overexpression lysate of HERV-H LTR-associating 3 (HHLA3), transcript variant 3 |
CNY 3,080.00 |
|
TP318069 | Recombinant protein of human HERV-H LTR-associating 3 (HHLA3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760309 | Recombinant protein of human HERV-H LTR-associating 3 (HHLA3), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP761643 | Purified recombinant protein of Human HERV-H LTR-associating 3 (HHLA3), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |