United States
Germany
Japan
United Kingdom
China
IL17 (IL17A) (NM_002190) Human Mass Spec Standard
CAT＃: PH318057
IL17A MS Standard C13 and N15-labeled recombinant protein (NP_002181)
View other "IL17" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | IL17A MS Standard C13 and N15-labeled recombinant protein (NP_002181) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218057 |
| Predicted MW | 17.5 kDa |
| Protein Sequence |
>RC218057 representing NM_002190
Red=Cloning site Green=Tags(s) MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRS TSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILV SVGCTCVTPIVHHVA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002181 |
| RefSeq Size | 1859 |
| RefSeq ORF | 465 |
| Synonyms | CTLA-8; CTLA8; IL-17; IL-17A; IL17; ILA17 |
| Locus ID | 3605 |
| Cytogenetics | 6p12.2 |
| Summary | This gene is a member of the IL-17 receptor family which includes five members (IL-17RA-E) and the encoded protein is a proinflammatory cytokine produced by activated T cells. IL-17A-mediated downstream pathways induce the production of inflammatory molecules, chemokines, antimicrobial peptides, and remodeling proteins. The encoded protein elicits crucial impacts on host defense, cell trafficking, immune modulation, and tissue repair, with a key role in the induction of innate immune defenses. This cytokine stimulates non-hematopoietic cells and promotes chemokine production thereby attracting myeloid cells to inflammatory sites. This cytokine also regulates the activities of NF-kappaB and mitogen-activated protein kinases and can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). IL-17A plays a pivotal role in various infectious diseases, inflammatory and autoimmune disorders, and cancer. High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The lung damage induced by the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is to a large extent, a result of the inflammatory response promoted by cytokines such as IL17A. [provided by RefSeq, Sep 2020] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400795 | IL17A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400795 | Transient overexpression lysate of interleukin 17A (IL17A) |
CNY 3,080.00 |
|
| TP318057 | Recombinant protein of human interleukin 17A (IL17A), 20 µg |
CNY 2,900.00 |
|
| TP720016 | Recombinant protein of human interleukin 17A (IL17A) |
CNY 3,140.00 |
|
| TP721376 | Recombinant mouse IL-17A protein |
CNY 1,688.00 |
|
| TP723711 | Purified recombinant protein of Human interleukin 17A (IL17A) |
CNY 4,090.00 |
|
| TP723780 | Purified recombinant protein of Human interleukin 17A and 17F (IL17A / IL-17F) heterodimer |
CNY 6,910.00 |
|
| TP762309 | Purified recombinant protein of Human interleukin 17A (IL17A), Gly24-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
