United States
Germany
Japan
United Kingdom
China
NAA60 (NM_024845) Human Mass Spec Standard
CAT＃: PH317832
NAT15 MS Standard C13 and N15-labeled recombinant protein (NP_079121)
View other "NAA60" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | NAT15 MS Standard C13 and N15-labeled recombinant protein (NP_079121) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217832 |
| Predicted MW | 27.3 kDa |
| Protein Sequence |
>RC217832 representing NM_024845
Red=Cloning site Green=Tags(s) MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAE IKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVL TTNNTAINFYENRDFKQHHYLPYYYSIRGVLKDGFTYVLYINGGHPPWTILDYIQHLGSALASLSPCSIP HRVYRQAHSLLCSFLPWSGISSKSGIEYSRTM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079121 |
| RefSeq Size | 2553 |
| RefSeq ORF | 726 |
| Synonyms | HAT4; hNaa60; NAT15; NatF |
| Locus ID | 79903 |
| Cytogenetics | 16p13.3 |
| Summary | This gene encodes an enzyme that localizes to the Golgi apparatus, where it transfers an acetyl group to the N-terminus of free proteins. This enzyme acts on histones, and its activity is important for chromatin assembly and chromosome integrity. Alternative splicing and the use of alternative promoters results in multiple transcript variants. The upstream promoter is located in a differentially methylated region (DMR) and undergoes imprinting; transcript variants originating from this position are expressed from the maternal allele. [provided by RefSeq, Nov 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411017 | NAA60 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421226 | NAA60 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421227 | NAA60 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411017 | Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 2 |
CNY 3,080.00 |
|
| LY421226 | Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 3 |
CNY 3,080.00 |
|
| LY421227 | Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 1 |
CNY 3,080.00 |
|
| PH313483 | NAT15 MS Standard C13 and N15-labeled recombinant protein (NP_001077070) |
CNY 19,520.00 |
|
| PH324843 | NAT15 MS Standard C13 and N15-labeled recombinant protein (NP_001077069) |
CNY 19,520.00 |
|
| TP313483 | Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP317832 | Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP324843 | Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 3, 20 µg |
CNY 2,900.00 |
