United States
Germany
Japan
United Kingdom
China
ARMCX3 (NM_177947) Human Mass Spec Standard
CAT＃: PH317732
ARMCX3 MS Standard C13 and N15-labeled recombinant protein (NP_808816)
View other "ARMCX3" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | ARMCX3 MS Standard C13 and N15-labeled recombinant protein (NP_808816) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217732 |
| Predicted MW | 42.5 kDa |
| Protein Sequence |
>RC217732 protein sequence
Red=Cloning site Green=Tags(s) MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNES KSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILE AALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDD TITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTREL LRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGI ESHHDFLVKVKVGKFMAKLAEHMFPKSQE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_808816 |
| RefSeq Size | 3367 |
| RefSeq ORF | 1137 |
| Synonyms | ALEX3; dJ545K15.2; GASP6 |
| Locus ID | 51566 |
| Cytogenetics | Xq22.1 |
| Summary | This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406053 | ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406054 | ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413862 | ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429505 | ARMCX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406053 | Transient overexpression lysate of armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 2 |
CNY 3,080.00 |
|
| LY406054 | Transient overexpression lysate of armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 3 |
CNY 3,080.00 |
|
| LY413862 | Transient overexpression lysate of armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 1 |
CNY 3,080.00 |
|
| TP317732 | Recombinant protein of human armadillo repeat containing, X-linked 3 (ARMCX3), transcript variant 2, 20 µg |
CNY 2,900.00 |
