SVH (ARMC10) (NM_031905) Human Mass Spec Standard
CAT#: PH317510
ARMC10 MS Standard C13 and N15-labeled recombinant protein (NP_114111)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ARMC10 MS Standard C13 and N15-labeled recombinant protein (NP_114111) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217510 |
Predicted MW | 37.4 kDa |
Protein Sequence |
>RC217510 representing NM_031905
Red=Cloning site Green=Tags(s) MGGPRGAGWVAAGLLLGAGACYCIYRLTRGRRRGDRELGIRSSKSAGALEEGTSEGQLCGRSARPQTGGT WESQWSKTSQPEDLTDGSYDDVLNAEQLQKLLYLLESTEDPVIIERALITLGNNAAFSVNQAIIRELGGI PIVANKINHSNQSIKEKALNALNNLSVNVENQIKIKIYISQVCEDVFSGPLNSAVQLAGLTLLTNMTVTN DHQHMLHSYITDLFQVLLTGNGNTKVQVLKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRV LTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_114111 |
RefSeq Size | 2629 |
RefSeq ORF | 1029 |
Synonyms | PNAS-112; PNAS112; PSEC0198; SVH |
Locus ID | 83787 |
Cytogenetics | 7q22.1 |
Summary | This gene encodes a protein that contains an armadillo repeat and transmembrane domain. The encoded protein decreases the transcriptional activity of the tumor suppressor protein p53 through direct interaction with the DNA-binding domain of p53, and may play a role in cell growth and survival. Upregulation of this gene may play a role in hepatocellular carcinoma. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 3. [provided by RefSeq, Sep 2011] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410452 | ARMC10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410452 | Transient overexpression lysate of armadillo repeat containing 10 (ARMC10), transcript variant A |
CNY 3,080.00 |
|
TP317510 | Recombinant protein of human armadillo repeat containing 10 (ARMC10), 20 µg |
CNY 2,900.00 |