CEACAM3 (NM_001815) Human Mass Spec Standard
CAT#: PH317469
CEACAM3 MS Standard C13 and N15-labeled recombinant protein (NP_001806)
View other "CEACAM3" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CEACAM3 MS Standard C13 and N15-labeled recombinant protein (NP_001806) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217469 |
Predicted MW | 27.1 kDa |
Protein Sequence |
>RC217469 protein sequence
Red=Cloning site Green=Tags(s) MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKG ERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHV YQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSM SPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001806 |
RefSeq Size | 1163 |
RefSeq ORF | 756 |
Synonyms | CD66D; CEA; CGM1; W264; W282 |
Locus ID | 1084 |
Cytogenetics | 19q13.2 |
Summary | This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2013] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419723 | CEACAM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419723 | Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) |
CNY 3,080.00 |
|
TP317469 | Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3), 20 µg |
CNY 2,900.00 |
|
TP720376 | Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3) |
CNY 3,140.00 |
其它CEACAM3产品