CYB5R2 (NM_016229) Human Mass Spec Standard
CAT#: PH317261
CYB5R2 MS Standard C13 and N15-labeled recombinant protein (NP_057313)
View other "CYB5R2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CYB5R2 MS Standard C13 and N15-labeled recombinant protein (NP_057313) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217261 |
Predicted MW | 21.54 kDa |
Protein Sequence |
>RC217261 representing NM_016229
Red=Cloning site Green=Tags(s) MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYT PVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTS EPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQVSSC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057313 |
RefSeq Size | 1341 |
RefSeq ORF | 1304 |
Synonyms | B5R.2 |
Locus ID | 51700 |
Cytogenetics | 11p15.4 |
Summary | The protein encoded by this gene belongs to the flavoprotein pyridine nucleotide cytochrome reductase family of proteins. Cytochrome b-type NAD(P)H oxidoreductases are implicated in many processes including cholesterol biosynthesis, fatty acid desaturation and elongation, and respiratory burst in neutrophils and macrophages. Cytochrome b5 reductases have soluble and membrane-bound forms that are the product of alternative splicing. In animal cells, the membrane-bound form binds to the endoplasmic reticulum, where it is a member of a fatty acid desaturation complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414112 | CYB5R2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414112 | Transient overexpression lysate of cytochrome b5 reductase 2 (CYB5R2) |
CNY 3,080.00 |
|
TP317261 | Recombinant protein of human cytochrome b5 reductase 2 (CYB5R2), 20 µg |
CNY 2,900.00 |