TAGLN3 (NM_001008273) Human Mass Spec Standard
CAT#: PH316395
TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008274)
View other "TAGLN3" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008274) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216395 |
Predicted MW | 22.5 kDa |
Protein Sequence |
>RC216395 protein sequence
Red=Cloning site Green=Tags(s) MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLY PPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKD DGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001008274 |
RefSeq Size | 1214 |
RefSeq ORF | 597 |
Synonyms | NP22; NP24; NP25 |
Locus ID | 29114 |
Cytogenetics | 3q13.2 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415704 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423411 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423412 | TAGLN3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415704 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 1 |
CNY 3,080.00 |
|
LY423411 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 2 |
CNY 3,080.00 |
|
LY423412 | Transient overexpression lysate of transgelin 3 (TAGLN3), transcript variant 3 |
CNY 3,080.00 |
|
PH304424 | TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_037391) |
CNY 19,520.00 |
|
PH323474 | TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008273) |
CNY 19,520.00 |
|
TP304424 | Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP316395 | Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP323474 | Recombinant protein of human transgelin 3 (TAGLN3), transcript variant 2, 20 µg |
CNY 2,900.00 |