CTDSPL (NM_005808) Human Mass Spec Standard
CAT#: PH314440
CTDSPL MS Standard C13 and N15-labeled recombinant protein (NP_005799)
View other "CTDSPL" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | CTDSPL MS Standard C13 and N15-labeled recombinant protein (NP_005799) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214440 |
Predicted MW | 29.8 kDa |
Protein Sequence |
>RC214440 representing NM_005808
Red=Cloning site Green=Tags(s) MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLV EENGGLQKPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHV DEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIV DNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005799 |
RefSeq Size | 4422 |
RefSeq ORF | 795 |
Synonyms | C3orf8; HYA22; PSR1; RBSP3; SCP3 |
Locus ID | 10217 |
Cytogenetics | 3p22.2 |
Summary | Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells (By similarity). Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401765 | CTDSPL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423419 | CTDSPL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401765 | Transient overexpression lysate of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2 |
CNY 3,080.00 |
|
LY423419 | Transient overexpression lysate of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1 |
CNY 3,080.00 |
|
TP314440 | Recombinant protein of human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760411 | Purified recombinant protein of Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like (CTDSPL), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |