XAGE3 (NM_133179) Human Mass Spec Standard
CAT#: PH314210
XAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_573440)
View other "XAGE3" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
CNY 3,080.00
Specifications
Product Data | |
Description | XAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_573440) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214210 |
Predicted MW | 12.3 kDa |
Protein Sequence |
>RC214210 protein sequence
Red=Cloning site Green=Tags(s) MIWRGRSTYRPRPRRSVPPPELIGPMLEPGDEEPQQEEPPTESRDPAPGQEREEDQGAAETQVPDLEADL QELSQSKTGGECGNGPDDQGKILPKSEQFKMPEGGDRQPQV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_573440 |
RefSeq Size | 543 |
RefSeq ORF | 333 |
Synonyms | CT12.3a; CT12.3b; GAGED4; PLAC6; pp9012; XAGE-3 |
Locus ID | 170626 |
Cytogenetics | Xp11.22 |
Summary | This gene is a member of the XAGE subfamily, which belongs to the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is expressed in placenta and fetal liver/spleen, and may function in inhibiting cancer cell growth. The protein encoded by this gene shares a sequence similarity with other GAGE/PAGE proteins. Because of the expression pattern and the sequence similarity, this protein also belongs to a family of CT (cancer-testis) antigens. Alternative splicing of this gene generates 2 transcript variants differing in the 5' UTR. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408847 | XAGE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408938 | XAGE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408847 | Transient overexpression lysate of X antigen family, member 3 (XAGE3), transcript variant 1 |
CNY 3,080.00 |
|
LY408938 | Transient overexpression lysate of X antigen family, member 3 (XAGE3), transcript variant 2 |
CNY 3,080.00 |
|
PH309351 | XAGE3 MS Standard C13 and N15-labeled recombinant protein (NP_570132) |
CNY 14,250.00 |
|
TP309351 | Purified recombinant protein of Homo sapiens X antigen family, member 3 (XAGE3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP314210 | Purified recombinant protein of Homo sapiens X antigen family, member 3 (XAGE3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760910 | Purified recombinant protein of Human X antigen family, member 3 (XAGE3), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |