GADD45B (NM_015675) Human Mass Spec Standard
CAT#: PH313354
GADD45B MS Standard C13 and N15-labeled recombinant protein (NP_056490)
View other "GADD45B" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GADD45B MS Standard C13 and N15-labeled recombinant protein (NP_056490) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213354 |
Predicted MW | 17.6 kDa |
Protein Sequence |
>RC213354 representing NM_015675
Red=Cloning site Green=Tags(s) MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIA LQIHFTLIQSFCCDNDINIVRVSGNARLAQLLGEPAETQGTTEARDLHCLPFLQNPHTDAWKSHGLVEVA SYCEESRGNNQWVPYISLQER myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056490 |
RefSeq Size | 1121 |
RefSeq ORF | 483 |
Synonyms | GADD45BETA; MYD118 |
Locus ID | 4616 |
Cytogenetics | 19p13.3 |
Summary | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, MAPK signaling pathway, p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414404 | GADD45B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414404 | Transient overexpression lysate of growth arrest and DNA-damage-inducible, beta (GADD45B) |
CNY 3,080.00 |
|
TP313354 | Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B), 20 µg |
CNY 2,900.00 |
|
TP720537 | Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B) |
CNY 3,140.00 |
|
TP761954 | Purified recombinant protein of Human growth arrest and DNA-damage-inducible, beta (GADD45B),full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,050.00 |
其它GADD45B产品