United States
Germany
Japan
United Kingdom
China
FGL1 (NM_004467) Human Mass Spec Standard
CAT＃: PH312499
FGL1 MS Standard C13 and N15-labeled recombinant protein (NP_004458)
View other "FGL1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | FGL1 MS Standard C13 and N15-labeled recombinant protein (NP_004458) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212499 |
| Predicted MW | 36.4 kDa |
| Protein Sequence |
>RC212499 protein sequence
Red=Cloning site Green=Tags(s) MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENT VIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDY ENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGT AGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTD NGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004458 |
| RefSeq Size | 1285 |
| RefSeq ORF | 936 |
| Synonyms | HFREP1; HP-041; HPS; LFIRE-1; LFIRE1 |
| Locus ID | 2267 |
| Cytogenetics | 8p22 |
| Summary | Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four alternatively spliced transcript variants encoding the same protein exist for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404456 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404457 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407794 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417967 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430179 | FGL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404456 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 3 |
CNY 3,080.00 |
|
| LY404457 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 4 |
CNY 3,080.00 |
|
| LY407794 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 2 |
CNY 3,080.00 |
|
| LY417967 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 1 |
CNY 3,080.00 |
|
| LY430179 | Transient overexpression lysate of fibrinogen-like 1 (FGL1), transcript variant 2 |
CNY 3,080.00 |
|
| PH302778 | FGL1 MS Standard C13 and N15-labeled recombinant protein (NP_963847) |
CNY 14,250.00 |
|
| TP302778 | Purified recombinant protein of Homo sapiens fibrinogen-like 1 (FGL1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP312499 | Recombinant protein of human fibrinogen-like 1 (FGL1), transcript variant 1, 20 µg |
CNY 2,900.00 |
