ASAH1 (NM_004315) Human Mass Spec Standard
CAT#: PH312434
ASAH1 MS Standard C13 and N15-labeled recombinant protein (NP_004306)
View other "ASAH1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ASAH1 MS Standard C13 and N15-labeled recombinant protein (NP_004306) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212434 |
Predicted MW | 46.3 kDa |
Protein Sequence |
>RC212434 representing NM_004315
Red=Cloning site Green=Tags(s) MNCCIGLGEKARGSHRASYPSLSALFTEASILGFGSFAVKAQWTEDCRKSTYPPSGPTYRGAVPWYTINL DLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD IPLGEIISFNIFYELFTICTSIVAEDKKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRN NKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDAMWIGFLTRTVLENSTSYE EAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRR TPAKMCLNRTSQENISFETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004306 |
RefSeq Size | 2503 |
RefSeq ORF | 1233 |
Synonyms | AC; ACDase; ASAH; PHP; PHP32; SMAPME |
Locus ID | 427 |
Cytogenetics | 8p22 |
Summary | This gene encodes a member of the acid ceramidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. Processing of this preproprotein generates alpha and beta subunits that heterodimerize to form the mature lysosomal enzyme, which catalyzes the degradation of ceramide into sphingosine and free fatty acid. This enzyme is overexpressed in multiple human cancers and may play a role in cancer progression. Mutations in this gene are associated with the lysosomal storage disorder, Farber lipogranulomatosis, and a neuromuscular disorder, spinal muscular atrophy with progressive myoclonic epilepsy. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome, Metabolic pathways, Sphingolipid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401373 | ASAH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426805 | ASAH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401373 | Transient overexpression lysate of N-acylsphingosine amidohydrolase (acid ceramidase) 1 (ASAH1), transcript variant 2 |
CNY 3,080.00 |
|
LY426805 | Transient overexpression lysate of N-acylsphingosine amidohydrolase (acid ceramidase) 1 (ASAH1), transcript variant 3 |
CNY 3,080.00 |
|
TP312434 | Recombinant protein of human N-acylsphingosine amidohydrolase (acid ceramidase) 1 (ASAH1), transcript variant 2, 20 µg |
CNY 2,900.00 |