United States
Germany
Japan
United Kingdom
China
PKIB (NM_181795) Human Mass Spec Standard
CAT＃: PH312372
PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861460)
View other "PKIB" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861460) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212372 |
| Predicted MW | 8.3 kDa |
| Protein Sequence |
>RC212372 representing NM_181795
Red=Cloning site Green=Tags(s) MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQL EKPQNEEK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_861460 |
| RefSeq Size | 1909 |
| RefSeq ORF | 234 |
| Synonyms | PRKACN2 |
| Locus ID | 5570 |
| Cytogenetics | 6q22.31 |
| Summary | This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role in prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405587 | PKIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405588 | PKIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410103 | PKIB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405587 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 2 |
CNY 3,080.00 |
|
| LY405588 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1 |
CNY 3,080.00 |
|
| LY410103 | Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3 |
CNY 3,080.00 |
|
| PH316291 | PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861459) |
CNY 19,520.00 |
|
| TP312372 | Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP316291 | Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720220 | Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3 |
CNY 3,140.00 |
|
| TP761370 | Purified recombinant protein of Human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 3, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
