OPCML (NM_001012393) Human Mass Spec Standard
CAT#: PH312254
OPCML MS Standard C13 and N15-labeled recombinant protein (NP_001012393)
View other "OPCML" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | OPCML MS Standard C13 and N15-labeled recombinant protein (NP_001012393) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212254 |
Predicted MW | 37.27 kDa |
Protein Sequence |
>RC212254 representing NM_001012393
Red=Cloning site Green=Tags(s) MYHPAYWVVFSATTALLFIPGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYA GNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITV NEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVK ITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVS EKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001012393 |
RefSeq Size | 6413 |
RefSeq ORF | 1014 |
Synonyms | IGLON1; OBCAM; OPCM |
Locus ID | 4978 |
Cytogenetics | 11q25 |
Summary | This gene encodes a member of the IgLON subfamily in the immunoglobulin protein superfamily of proteins. The encoded preprotein is proteolytically processed to generate the mature protein. This protein is localized in the plasma membrane and may have an accessory role in opioid receptor function. This gene has an ortholog in rat and bovine. The opioid binding-cell adhesion molecule encoded by the rat gene binds opioid alkaloids in the presence of acidic lipids, exhibits selectivity for mu ligands and acts as a GPI-anchored protein. Since the encoded protein is highly conserved in species during evolution, it may have a fundamental role in mammalian systems. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400389 | OPCML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419251 | OPCML HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400389 | Transient overexpression lysate of opioid binding protein/cell adhesion molecule-like (OPCML), transcript variant 2 |
CNY 3,080.00 |
|
LY419251 | Transient overexpression lysate of opioid binding protein/cell adhesion molecule-like (OPCML), transcript variant 1 |
CNY 3,080.00 |
|
TP312254 | Recombinant protein of human opioid binding protein/cell adhesion molecule-like (OPCML), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP761875 | Purified recombinant protein of Human opioid binding protein/cell adhesion molecule-like (OPCML), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |