CTAG2 (NM_172377) Human Mass Spec Standard
CAT#: PH311659
CTAG2 MS Standard C13 and N15-labeled recombinant protein (NP_758965)
View other "CTAG2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | CTAG2 MS Standard C13 and N15-labeled recombinant protein (NP_758965) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211659 |
Predicted MW | 18.3 kDa |
Protein Sequence |
>RC211659 protein sequence
Red=Cloning site Green=Tags(s) MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAAS AQDGRCPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFIRLTAA DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQAPSGQRR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_758965 |
RefSeq Size | 773 |
RefSeq ORF | 540 |
Synonyms | CAMEL; CT2; CT6.2; CT6.2a; CT6.2b; ESO2; LAGE-1; LAGE2B |
Locus ID | 30848 |
Cytogenetics | Xq28 |
Summary | This gene encodes an autoimmunogenic tumor antigen that belongs to the ESO/LAGE family of cancer-testis antigens. This protein is expressed in a wide array of cancers including melanoma, breast cancer, bladder cancer and prostate cancer. This protein is also expressed in normal testis tissue. An alternative open reading frame product of this gene has been described in PMID:10399963. This alternate protein, termed CAMEL, is a tumor antigen that is recognized by melanoma-specific cytotoxic T-lymphocytes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406703 | CTAG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406703 | Transient overexpression lysate of cancer/testis antigen 2 (CTAG2), transcript variant 1 |
CNY 3,080.00 |
|
TP311659 | Recombinant protein of human cancer/testis antigen 2 (CTAG2), transcript variant 1, 20 µg |
CNY 2,900.00 |