United States
Germany
Japan
United Kingdom
China
MAL (NM_022440) Human Mass Spec Standard
CAT＃: PH311612
MAL MS Standard C13 and N15-labeled recombinant protein (NP_071885)
View other "MAL" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | MAL MS Standard C13 and N15-labeled recombinant protein (NP_071885) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211612 |
| Predicted MW | 5.8 kDa |
| Protein Sequence |
>RC211612 representing NM_022440
Red=Cloning site Green=Tags(s) MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFVFSYIATLLYVVHAVFSLIRWKSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_071885 |
| RefSeq Size | 762 |
| RefSeq ORF | 165 |
| Synonyms | MVP17; VIP17 |
| Locus ID | 4118 |
| Cytogenetics | 2q11.1 |
| Summary | The protein encoded by this gene is a highly hydrophobic integral membrane protein belonging to the MAL family of proteolipids. The protein has been localized to the endoplasmic reticulum of T-cells and is a candidate linker protein in T-cell signal transduction. In addition, this proteolipid is localized in compact myelin of cells in the nervous system and has been implicated in myelin biogenesis and/or function. The protein plays a role in the formation, stabilization and maintenance of glycosphingolipid-enriched membrane microdomains. Down-regulation of this gene has been associated with a variety of human epithelial malignancies. Alternative splicing produces four transcript variants which vary from each other by the presence or absence of alternatively spliced exons 2 and 3. [provided by RefSeq, May 2012] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400850 | MAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411702 | MAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411704 | MAL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400850 | Transient overexpression lysate of mal, T-cell differentiation protein (MAL), transcript variant a |
CNY 3,080.00 |
|
| LY411702 | Transient overexpression lysate of mal, T-cell differentiation protein (MAL), transcript variant b |
CNY 3,080.00 |
|
| LY411704 | Transient overexpression lysate of mal, T-cell differentiation protein (MAL), transcript variant d |
CNY 3,080.00 |
|
| PH301256 | MAL MS Standard C13 and N15-labeled recombinant protein (NP_002362) |
CNY 19,520.00 |
|
| PH317248 | MAL MS Standard C13 and N15-labeled recombinant protein (NP_071883) |
CNY 19,520.00 |
|
| TP301256 | Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant a, 20 µg |
CNY 2,900.00 |
|
| TP311612 | Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant d, 20 µg |
CNY 2,900.00 |
|
| TP317248 | Recombinant protein of human mal, T-cell differentiation protein (MAL), transcript variant b, 20 µg |
CNY 2,900.00 |
