Retinoic Acid Receptor gamma (RARG) (NM_000966) Human Mass Spec Standard
CAT#: PH310815
RARG MS Standard C13 and N15-labeled recombinant protein (NP_000957)
View other "Retinoic Acid Receptor gamma" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | RARG MS Standard C13 and N15-labeled recombinant protein (NP_000957) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210815 |
Predicted MW | 50.3 kDa |
Protein Sequence |
>RC210815 protein sequence
Red=Cloning site Green=Tags(s) MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSS EEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRN RCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKY TTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYT PEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKV DKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000957 |
RefSeq Size | 2992 |
RefSeq ORF | 1362 |
Synonyms | NR1B3; RARC |
Locus ID | 5916 |
Cytogenetics | 12q13.13 |
Summary | This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimers to the retinoic acid response elements (RARE) found in the promoter regions of the target genes. In their unbound form, RARs repress transcription of their target genes. RARs are involved in various biological processes, including limb bud development, skeletal growth, and matrix homeostasis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400354 | RARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420799 | RARG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400354 | Transient overexpression lysate of retinoic acid receptor, gamma (RARG), transcript variant 1 |
CNY 3,080.00 |
|
LY420799 | Transient overexpression lysate of retinoic acid receptor, gamma (RARG), transcript variant 2 |
CNY 4,840.00 |
|
TP310815 | Recombinant protein of human retinoic acid receptor, gamma (RARG), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Retinoic Acid Receptor gamma产品