CGRP (CALCB) (NM_000728) Human Mass Spec Standard
CAT#: PH310496
CALCB MS Standard C13 and N15-labeled recombinant protein (NP_000719)
View other "CGRP" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CALCB MS Standard C13 and N15-labeled recombinant protein (NP_000719) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210496 |
Predicted MW | 13.7 kDa |
Protein Sequence |
>RC210496 protein sequence
Red=Cloning site Green=Tags(s) MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQE TQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000719 |
RefSeq Size | 1031 |
RefSeq ORF | 381 |
Synonyms | CALC2; CGRP-II; CGRP2 |
Locus ID | 797 |
Cytogenetics | 11p15.2 |
Summary | CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424540 | CALCB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424540 | Transient overexpression lysate of calcitonin-related polypeptide beta (CALCB) |
CNY 3,080.00 |
|
TP310496 | Recombinant protein of human calcitonin-related polypeptide beta (CALCB), 20 µg |
CNY 2,900.00 |
|
TP721150 | Purified recombinant protein of Human calcitonin-related polypeptide beta (CALCB) |
CNY 3,140.00 |