ANKRD2 (NM_020349) Human Mass Spec Standard
CAT#: PH310468
ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_065082)
View other "ANKRD2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_065082) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210468 |
Predicted MW | 39.9 kDa |
Protein Sequence |
>RC210468 protein sequence
Red=Cloning site Green=Tags(s) MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDL LVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEP EEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQ DRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREG DTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSG RETPQPVPAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065082 |
RefSeq Size | 1520 |
RefSeq ORF | 1080 |
Synonyms | ARPP |
Locus ID | 26287 |
Cytogenetics | 10q24.2 |
Summary | This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412545 | ANKRD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427086 | ANKRD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412545 | Transient overexpression lysate of ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 1 |
CNY 3,080.00 |
|
LY427086 | Transient overexpression lysate of ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 2 |
CNY 3,080.00 |
|
PH325475 | ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_001123453) |
CNY 14,250.00 |
|
TP310468 | Recombinant protein of human ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP325475 | Purified recombinant protein of Homo sapiens ankyrin repeat domain 2 (stretch responsive muscle) (ANKRD2), transcript variant 2, 20 µg |
CNY 2,900.00 |