EBP1 (PA2G4) (NM_006191) Human Mass Spec Standard
CAT#: PH310230
PA2G4 MS Standard C13 and N15-labeled recombinant protein (NP_006182)
View other "EBP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PA2G4 MS Standard C13 and N15-labeled recombinant protein (NP_006182) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210230 |
Predicted MW | 43.6 kDa |
Protein Sequence |
>RC210230 representing NM_006191
Red=Cloning site Green=Tags(s) MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEM KKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQVTGRKA DVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQK KDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTL RAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ DAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006182 |
RefSeq Size | 2643 |
RefSeq ORF | 1182 |
Synonyms | EBP1; HG4-1; p38-2G4 |
Locus ID | 5036 |
Cytogenetics | 12q13.2 |
Summary | This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protease, Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416812 | PA2G4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416812 | Transient overexpression lysate of proliferation-associated 2G4, 38kDa (PA2G4) |
CNY 3,080.00 |
|
TP310230 | Recombinant protein of human proliferation-associated 2G4, 38kDa (PA2G4), 20 µg |
CNY 2,900.00 |