EIF4EBP3 (NM_003732) Human Mass Spec Standard
CAT#: PH310053
EIF4EBP3 MS Standard C13 and N15-labeled recombinant protein (NP_003723)
View other "EIF4EBP3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | EIF4EBP3 MS Standard C13 and N15-labeled recombinant protein (NP_003723) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210053 |
Predicted MW | 10.9 kDa |
Protein Sequence |
>RC210053 protein sequence
Red=Cloning site Green=Tags(s) MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTP PTAPLSKLEELKEQETEEEIPDDAQFEMDI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003723 |
RefSeq Size | 728 |
RefSeq ORF | 300 |
Synonyms | 4E-BP3; 4EBP3 |
Locus ID | 8637 |
Cytogenetics | 5q31.3 |
Summary | This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq, Oct 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418472 | EIF4EBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418472 | Transient overexpression lysate of eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3) |
CNY 3,080.00 |
|
TP310053 | Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3), 20 µg |
CNY 2,900.00 |
其它EIF4EBP3产品