Pepsinogen II (PGC) (NM_002630) Human Mass Spec Standard
CAT#: PH310051
PGC MS Standard C13 and N15-labeled recombinant protein (NP_002621)
View other "Pepsinogen II" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | PGC MS Standard C13 and N15-labeled recombinant protein (NP_002621) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210051 |
Predicted MW | 42.4 kDa |
Protein Sequence |
>RC210051 protein sequence
Red=Cloning site Green=Tags(s) MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMD AAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLT GFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVF SVYLSNQQGSSGGAVVFGGVDSSLYTGQIYWAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTS LLTVPQQYMSALLQATGAQEDEYGQFLVNCNSIQNLPSLTFIINGVEFPLPPSSYILSNNGYCTVGVEPT YLSSQNGQPLWILGDVFLRSYYSVYDLGNNRVGFATAA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002621 |
RefSeq Size | 1392 |
RefSeq ORF | 1164 |
Synonyms | PEPC; PGII |
Locus ID | 5225 |
Cytogenetics | 6p21.1 |
Summary | This gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the serum. This protein is synthesized as an inactive zymogen that includes a highly basic prosegment. This enzyme is converted into its active mature form at low pH by sequential cleavage of the prosegment that is carried out by the enzyme itself. Polymorphisms in this gene are associated with susceptibility to gastric cancers. Serum levels of this enzyme are used as a biomarker for certain gastric diseases including Helicobacter pylori related gastritis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1. [provided by RefSeq, Oct 2009] |
Protein Families | Protease, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419201 | PGC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432872 | PGC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419201 | Transient overexpression lysate of progastricsin (pepsinogen C) (PGC), transcript variant 1 |
CNY 3,080.00 |
|
LY432872 | Transient overexpression lysate of progastricsin (pepsinogen C) (PGC), transcript variant 2 |
CNY 3,080.00 |
|
TP310051 | Recombinant protein of human progastricsin (pepsinogen C) (PGC), 20 µg |
CNY 2,900.00 |
其它Pepsinogen II产品