C13orf15 (RGCC) (NM_014059) Human Mass Spec Standard
CAT#: PH309810
C13orf15 MS Standard C13 and N15-labeled recombinant protein (NP_054778)
View other "C13orf15" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | C13orf15 MS Standard C13 and N15-labeled recombinant protein (NP_054778) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209810 |
Predicted MW | 14.6 kDa |
Protein Sequence |
>RC209810 protein sequence
Red=Cloning site Green=Tags(s) MKQPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSD SSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054778 |
RefSeq Size | 1126 |
RefSeq ORF | 411 |
Synonyms | bA157L14.2; C13orf15; RGC-32; RGC32 |
Locus ID | 28984 |
Cytogenetics | 13q14.11 |
Summary | This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415502 | RGCC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415502 | Transient overexpression lysate of chromosome 13 open reading frame 15 (C13orf15) |
CNY 3,080.00 |
|
TP309810 | Recombinant protein of human chromosome 13 open reading frame 15 (C13orf15), 20 µg |
CNY 2,900.00 |
其它C13orf15产品