LRP15 (LRRC3B) (NM_052953) Human Mass Spec Standard
CAT#: PH309766
LRRC3B MS Standard C13 and N15-labeled recombinant protein (NP_443185)
View other "LRP15" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LRRC3B MS Standard C13 and N15-labeled recombinant protein (NP_443185) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209766 |
Predicted MW | 29.3 kDa |
Protein Sequence |
>RC209766 protein sequence
Red=Cloning site Green=Tags(s) MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLY LDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARA RIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDYAMLVTM FGWFTMVISYVVYYVRQNQEDARRHLEYLKSLPSRQKKADEPDDISTVV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_443185 |
RefSeq Size | 1718 |
RefSeq ORF | 777 |
Synonyms | LRP15 |
Locus ID | 116135 |
Cytogenetics | 3p24.1 |
Summary | The protein encoded by this gene is a tumor suppressor, with lowered expression levels found in gastric, renal, colorectal, lung, and breast cancer tissues. The promoter of this gene is frequently hypermethylated in these cancer tissues, although the hypermethylation does not appear to be the cause of the reduced expression of this gene. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Dec 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409370 | LRRC3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409370 | Transient overexpression lysate of leucine rich repeat containing 3B (LRRC3B) |
CNY 3,080.00 |
|
TP309766 | Recombinant protein of human leucine rich repeat containing 3B (LRRC3B), 20 µg |
CNY 2,900.00 |