ATP6V1B1 (NM_001692) Human Mass Spec Standard
CAT#: PH309462
ATP6V1B1 MS Standard C13 and N15-labeled recombinant protein (NP_001683)
View other "ATP6V1B1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ATP6V1B1 MS Standard C13 and N15-labeled recombinant protein (NP_001683) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209462 |
Predicted MW | 56.8 kDa |
Protein Sequence |
>RC209462 protein sequence
Red=Cloning site Green=Tags(s) MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFAQYAEIVHFTL PDGTQRSGQVLEVAGTKAIVQVFEGTSGIDARKTTCEFTGDILRTPVSEDMLGRVFNGSGKPIDKGPVVM AEDFLDINGQPINPHSRIYPEEMIQTGISPIDVMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKS KAVLDYHDDNFAIVFAAMGVNMETARFFKSDFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLA YQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTM PNDDITHPIPDLTGFITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACY AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFINQGPYENRSVFESLDLGWKLLRIFPKEMLKRIP QAVIDEFYSREGALQDLAPDTAL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001683 |
RefSeq Size | 1956 |
RefSeq ORF | 1539 |
Synonyms | ATP6B1; DRTA2; RTA1B; VATB; VMA2; VPP3 |
Locus ID | 525 |
Cytogenetics | 2p13.3 |
Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain B subunit isoforms and is found in the kidney. Mutations in this gene cause distal renal tubular acidosis associated with sensorineural deafness. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400635 | ATP6V1B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400635 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1 (ATP6V1B1) |
CNY 3,080.00 |
|
TP309462 | Recombinant protein of human ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1 (ATP6V1B1), 20 µg |
CNY 2,900.00 |
其它ATP6V1B1产品