LCN1 (NM_002297) Human Mass Spec Standard
CAT#: PH309363
LCN1 MS Standard C13 and N15-labeled recombinant protein (NP_002288)
View other "LCN1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LCN1 MS Standard C13 and N15-labeled recombinant protein (NP_002288) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209363 |
Predicted MW | 19.3 kDa |
Protein Sequence |
>RC209363 protein sequence
Red=Cloning site Green=Tags(s) MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAK VTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKN NLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002288 |
RefSeq Size | 789 |
RefSeq ORF | 528 |
Synonyms | PMFA; TLC; TP; VEGP |
Locus ID | 3933 |
Cytogenetics | 9q34.3 |
Summary | This gene encodes a member of the lipocalin family of small secretory proteins. Lipocalins are extracellular transport proteins that bind to a variety of hydrophobic ligands. The encoded protein is the primary lipid binding protein in tears and is overproduced in response to multiple stimuli including infection and stress. The encoded protein may be a marker for chromosome aneuploidy as well as an autoantigen in Sjogren's syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and two pseudogenes of this gene are also located on the long arm of chromosome 9. [provided by RefSeq, Nov 2011] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419409 | LCN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419409 | Transient overexpression lysate of lipocalin 1 (tear prealbumin) (LCN1) |
CNY 3,080.00 |
|
TP309363 | Recombinant protein of human lipocalin 1 (tear prealbumin) (LCN1), 20 µg |
CNY 2,900.00 |